PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02864.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 421aa    MW: 45844 Da    PI: 8.3698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02864.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-161461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WTteEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  Zmw_sc02864.1.g00020.1.am.mk 14 KGPWTTEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                                  79******************************99************97 PP

2Myb_DNA-binding48.81.6e-1570131447
                                   S-HHHHHHHHHHHHHTTTT...................-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   4 WTteEdellvdavkqlGgg...................tWktIartmgkgRtlkqcksrwqky 47 
                                    + eE+ l +d+++qlG++                   +W++Ia++++ gRt++++k++w+++
  Zmw_sc02864.1.g00020.1.am.mk  70 LSDEEEALVIDLHAQLGNRslagrwlvppkltaplvfcRWSKIAARLP-GRTDNEIKNHWNTH 131
                                   589*********************************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-20562IPR009057Homeodomain-like
PROSITE profilePS5129420.991965IPR017930Myb domain
SMARTSM007172.5E-121363IPR001005SANT/Myb domain
PfamPF002493.7E-141461IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-221465IPR009057Homeodomain-like
CDDcd001677.64E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2263136IPR009057Homeodomain-like
PROSITE profilePS5129414.60766136IPR017930Myb domain
SMARTSM007176.9E-1166134IPR001005SANT/Myb domain
PfamPF002491.5E-1270131IPR001005SANT/Myb domain
CDDcd001678.26E-1071132No hitNo description
SuperFamilySSF466891.94E-22105133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTTE EDQKLVTFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDEEEALVID LHAQLGNRSL AGRWLVPPKL TAPLVFCRWS KIAARLPGRT  120
DNEIKNHWNT HIKKKLRKMG IDPVTHRPLS PSQSGEPLSQ QRQQRQDPPH EREKGRDEPK  180
ASSEGPAGSD QDDESEETPV SGAQPQVAAA SSPASTAATV SPSCSSSGSA SVATPGADVA  240
AWPDPIDLFE VDGMMDLDWA AILSGCGDDG AGMNVDLFDH YPGDGFDEQV WSMHGLRRGE  300
KPVPVVARSI TGVVVEPAAH EEVDLVRSPA SAGNTTPELT RRDPIGQTAG QGRDLWRKLR  360
APPVPSTSAN KGMPRHLLVA TPVLARTSRR LVFSFVPFPL RGVTSASRHG CVTSFTRAIC  420
W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121365108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953828.11e-132PREDICTED: protein ODORANT1-like
TrEMBLK3Z1081e-132K3Z108_SETIT; Uncharacterized protein
STRINGSi020225m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563